53BP1 Rabbit monoclonal antibody
Produktgrößen
5 ul
£ POA
A3859-5UL
20 ul
£164,00
A3859-20UL
100 ul
£342,00
A3859-100UL
500 ul
£1532,00
A3859-500UL
1000 ul
£2704,00
A3859-1000UL
Über dieses Produkt
- SKU:
- A3859
- Zusätzliche Namen:
- 53BP1|p202|p53BP1|TDRD30
- Anwendung:
- ELISA, IHC-Paraffin, Immunocytochemistry, Immunofluorescence
- Klonalität:
- Monoclonal
- Weitere Details:
- This gene encodes a protein that functions in the DNA double-strand break repair pathway choice, promoting non-homologous end joining (NHEJ) pathways, and limiting homologous recombination. This protein plays multiple roles in the DNA damage response, including promoting checkpoint signaling following DNA damage, acting as a scaffold for recruitment of DNA damage response proteins to damaged chromatin, and promoting NHEJ pathways by limiting end resection following a double-strand break. These roles are also important during V(D)J recombination, class switch recombination and at unprotected telomeres. Alternative splicing results in multiple transcript variants encoding different isoforms.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- Refer to figures
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse
- Sequenz:
- MDPTGSQLDSDFSQQDTPCLIIEDSQPESQVLEDDSGSHFSMLSRHLPNLQTHKENPVLDVVSNPEQTAGEERGDGNSGFNEHLKENKVADPVDSSNLDT
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A3859