SFTPA1 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A3133-20UL
100 ul
£336,00
A3133-100UL
500 ul
£1258,00
A3133-500UL
1000 ul
£2228,00
A3133-1000UL
Über dieses Produkt
- SKU:
- A3133
- Zusätzliche Namen:
- COLEC4|ILD1|PSAP|PSP-A|PSPA|SFTP1|SFTPA1|SFTPA1B|SP-A|SP-A1|SP-A1 beta|SP-A1 delta|SP-A1 epsilon|SP-A1 gamma|SPA|SPA1
- Anwendung:
- ELISA, IHC-Paraffin, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- This gene encodes a lung surfactant protein that is a member of a subfamily of C-type lectins called collectins. The encoded protein binds specific carbohydrate moieties found on lipids and on the surface of microorganisms. This protein plays an essential role in surfactant homeostasis and in the defense against respiratory pathogens. Mutations in this gene are associated with idiopathic pulmonary fibrosis. Alternate splicing results in multiple transcript variants.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 30kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- RGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGK
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A3133