PLIN5 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A28371-20UL
100 ul
£336,00
A28371-100UL
500 ul
£1258,00
A28371-500UL
1000 ul
£2228,00
A28371-1000UL
Über dieses Produkt
- SKU:
- A28371
- Zusätzliche Namen:
- 2310076L09Rik|Lsdp5|MLDP|PAT-1
- Anwendung:
- ELISA, IHC-Paraffin, Immunofluorescence, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Enables identical protein binding activity and lipase binding activity. Involved in several processes, including negative regulation of peroxisome proliferator activated receptor signaling pathway; positive regulation of triglyceride storage; and regulation of lipid metabolic process. Located in cytosol. Colocalizes with lipid droplet. Is expressed in brown fat. Orthologous to human PLIN5 (perilipin 5).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 55 kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse, Rat
- Sequenz:
- GSVARAHACVDEFLDLVLRAMPLPWLVGPFAPILVEQSEPLINLATCVDEVVGDPDPRWAHMDWPAQKRAWEAESADPGGQEAEPPRGQGKHTMMPELDF
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A28371