Serotonin transporter Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A28369-20UL
100 ul
£336,00
A28369-100UL
500 ul
£1258,00
A28369-500UL
1000 ul
£2228,00
A28369-1000UL
Über dieses Produkt
- SKU:
- A28369
- Zusätzliche Namen:
- 5-HTT|Htt|Sert
- Anwendung:
- ELISA, IHC-Paraffin, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Enables neurotransmitter transmembrane transporter activity; nitric-oxide synthase binding activity; and serotonin:sodium:chloride symporter activity. Involved in several processes, including nervous system development; platelet aggregation; and serotonin uptake. Located in focal adhesion and synapse. Is expressed in several structures, including early conceptus; heart; liver; nervous system; and ovary. Used to study autism spectrum disorder and sudden infant death syndrome. Human ortholog(s) of this gene implicated in several diseases, including alcohol dependence; anxiety disorder (multiple); depressive disorder (multiple); heart disease (multiple); and substance abuse (multiple). Orthologous to human SLC6A4 (solute carrier family 6 member 4).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 83 kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse, Rat
- Sequenz:
- METTPLNSQKVLSECKDKEDCQENGVLQKGVPTPADKAGPGQISNGYSAVPSTSAGDEAPHSTPAATTTLVAEIHQGERETWGKK
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A28369