PE Rabbit anti-Rat CD8a monoclonal antibody
Produktgrößen
2.5 ug
£ POA
A28358-2.5UG
50 ug
£134,00
A28358-50UG
100 ug
£277,00
A28358-100UG
Über dieses Produkt
- SKU:
- A28358
- Zusätzliche Namen:
- CD8A Alpha|Ly-2|Lyt2|T8
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Weitere Details:
- CD8a, a 32 kDa glycoprotein also known as T8, Lyt2, Ly-2, and CD8A Alpha, is a member of the immunoglobulin superfamily. It is expressed on most thymocytes, subsets of mature T cells, the majority of NK cells, macrophages, and some activated (non-resting) CD4+ T cells. CD8a forms a heterodimer with the CD8B Beta chain (CD8b) on the surface of most thymocytes. In contrast, mature peripheral T lymphocytes predominantly express the CD8 A AlphaB Beta heterodimer. Intestinal intraepithelial lymphocytes express CD8a but lack CD8b expression. CD8 functions as an antigen co-receptor on T cells, interacting with Major Histocompatibility Complex (MHC) class I molecules on antigen-presenting cells or epithelial cells. CD8 participates in T cell activation by associating with the T cell receptor (TCR) complex and the protein tyrosine kinase lck (p56lck).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 32 kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Rat
- Sequenz:
- GQLQLSPKKVDAEIGQEVKLTCEVLRDTSQGCSWLFRNSSSELLQPTFIIYVSSSRSKLNDILDPNLFSARKENNKYILTLSKFSTKNQGYYFCSITSNSVMYFSPLVPVFQKVNSIITKPVTRAPTPVPPPTGTPRPLRPEACRPGASGSVEGMGLGFACDIY
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A28358