PE Rabbit anti-Rat CD25 monoclonal antibody
Produktgrößen
2.5 ug
£ POA
A28355-2.5UG
50 ug
£152,00
A28355-50UG
100 ug
£229,00
A28355-100UG
Über dieses Produkt
- SKU:
- A28355
- Zusätzliche Namen:
- IL2RAC
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Weitere Details:
- CD25, also known as the interleukin-2 receptor alpha chain (IL-2RA Alpha). It is widely expressed on activated T and B cells in rats, subsets of thymic and splenic dendritic cells, as well as on intestinal epithelial cells. IL-2 is a key cytokine involved in lymphocyte proliferation and clonal expansion. Signaling through IL-2 requires the high-affinity IL-2 receptor, which is composed of the A Alpha (CD25), B Beta (CD122), and G Gamma (CD132) chains.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 31 kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Rat
- Sequenz:
- ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLNELVYMACLGNSWSNNCQCTSNSHDNSREQVTPQPEGQKEQQTTDTQKSTQSVYQENLAGHCREPPPWRHEDTKRIYHFVEGQIVLYTCIQGYKALQRGPAISICKTVCGEIRWTHPQLTCVDEKEHHQFLASEESQGSRNSFPESEASCPTPNTDFSQLTEATTTMETFVFTKEYQ
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A28355