MYH6/AA Alpha-MHC Rabbit monoclonal antibody
Produktgrößen
5 ul
£ POA
A28325-5UL
20 ul
£164,00
A28325-20UL
100 ul
£342,00
A28325-100UL
500 ul
£1455,00
A28325-500UL
1000 ul
£2704,00
A28325-1000UL
Über dieses Produkt
- SKU:
- A28325
- Zusätzliche Namen:
- A830009F23Rik|alpha-MHC|alphaMHC|Myhc-a|Myhca
- Anwendung:
- ELISA, IHC-Paraffin, Immunofluorescence, Western Blot
- Klonalität:
- Monoclonal
- Weitere Details:
- Enables microfilament motor activity. Involved in cardiac muscle contraction. Acts upstream of or within several processes, including adult heart development; regulation of heart contraction; and striated muscle cell development. Located in Z disc and stress fiber. Part of myosin complex. Is expressed in several structures, including brown fat; embryo mesenchyme; great vessel of heart; heart; and skeletal musculature. Used to study dilated cardiomyopathy; dilated cardiomyopathy 1EE; and hypertrophic cardiomyopathy 14. Human ortholog(s) of this gene implicated in atrial heart septal defect (multiple); heart conduction disease (multiple); and intrinsic cardiomyopathy (multiple). Orthologous to human MYH6 (myosin heavy chain 6).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 250 kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse, Rat
- Sequenz:
- LFSTYASADTGDSGKGKGGKKKGSSFQTVSALHRENLNKLMTNLKTTHPHFVRCIIPNERKAPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDF
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A28325