PE Rabbit anti-Mouse CD301b/MGL2 monoclonal antibody
Produktgrößen
2.5 ug
£ POA
A28266-2.5UG
25 ug
£146,00
A28266-25UG
100 ug
£265,00
A28266-100UG
Über dieses Produkt
- SKU:
- A28266
- Zusätzliche Namen:
- CD301b
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Weitere Details:
- Enables carbohydrate binding activity. Predicted to be involved in immune response. Predicted to be active in external side of plasma membrane. Is expressed in several structures, including hemolymphoid system gland; ileum; liver; lung; and male reproductive gland or organ. Orthologous to human CLEC10A (C-type lectin domain containing 10A).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- Refer to figures
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- QNFLQNRLANVLSWMGLTDQNGPWRWVDGTDFDKGFKNWRPLQPDNWHGHMLGGGEDCAHFSYDGRWNDDVCQRHYHWICETELGKASSAHSPQLIASVP
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A28266