ABflo[R] 594 Rabbit anti-Mouse CX3CR1 monoclonal antibody
Produktgrößen
5 ug
£ POA
A28252-5UG
25 ug
£164,00
A28252-25UG
100 ug
£306,00
A28252-100UG
Über dieses Produkt
- SKU:
- A28252
- Zusätzliche Namen:
- mCX3CR1
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Konjugat:
- ABflo® 647
- Weitere Details:
- Enables C-X3-C chemokine binding activity and C-X3-C chemokine receptor activity. Involved in several processes, including antifungal innate immune response; central nervous system development; and synapse organization. Located in cell surface. Is expressed in several structures, including brain; colon; genitourinary system; head mesenchyme; and meninges. Used to study age related macular degeneration 12. Human ortholog(s) of this gene implicated in several diseases, including human immunodeficiency virus infectious disease; obesity; pulmonary hypertension; retinal disease (multiple); and systemic scleroderma. Orthologous to human CX3CR1 (C-X3-C motif chemokine receptor 1).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 40 kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- MSTSFPELDLENFEYDDSAEACYLGDIVAFGTIFLSVFYALVFTFGLVGNLLVVLALTNSRKPKSITDIYLLNLALSDLLFVATLPFWTHYLISHEGLHN
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A28252