Podoplanin Rabbit monoclonal antibody
Produktgrößen
5 ul
£ POA
A28229-5UL
20 ul
£164,00
A28229-20UL
100 ul
£342,00
A28229-100UL
500 ul
£1455,00
A28229-500UL
1000 ul
£2704,00
A28229-1000UL
Über dieses Produkt
- SKU:
- A28229
- Zusätzliche Namen:
- E11|Gp38|OTS-8|RANDAM-2|T1-alpha|T1a|T1alpha
- Anwendung:
- ELISA, IHC-Paraffin, Immunofluorescence, Western Blot
- Klonalität:
- Monoclonal
- Weitere Details:
- Predicted to enable chemokine binding activity; protein-folding chaperone binding activity; and signaling receptor binding activity. Involved in several processes, including lymph node development; lymphatic endothelial cell fate commitment; and positive regulation of platelet aggregation. Acts upstream of or within several processes, including lung alveolus development; lymphangiogenesis; and prostaglandin metabolic process. Located in several cellular components, including external side of plasma membrane; lamellipodium; and ruffle. Is expressed in several structures, including brain; cardiovascular system; genitourinary system; hemolymphoid system; and respiratory system. Orthologous to human PDPN (podoplanin).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 36 kda
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- QGGTIGVNEDDIVTPGTGDGMVPPGIEDKITTTGATGGLNESTGKAPLVPTQRERGTKPPLEELSTSATSDHDHREHESTTTVKVVTSHSVDKKTSHPNRDNAGDETQTTDKK
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A28229