PE Rabbit anti-Mouse T-bet/Tbx21 monoclonal antibody
Produktgrößen
2.5 ug
£ POA
A28217-2.5UG
25 ug
£164,00
A28217-25UG
100 ug
£354,00
A28217-100UG
Über dieses Produkt
- SKU:
- A28217
- Zusätzliche Namen:
- Tbet|Tblym|TBT1
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Weitere Details:
- Enables DNA binding activity and DNA-binding transcription activator activity, RNA polymerase II-specific. Involved in several processes, including T-helper 1 cell lineage commitment; negative regulation of T-helper 17 cell lineage commitment; and regulation of gene expression. Acts upstream of or within T cell differentiation and positive regulation of isotype switching to IgG isotypes. Located in neuronal cell body and nucleus. Is expressed in several structures, including central nervous system; colon; genitourinary system; sensory organ; and thymus. Used to study asthma. Human ortholog(s) of this gene implicated in asthma, nasal polyps, and aspirin intolerance and immunodeficiency 88. Orthologous to human TBX21 (T-box transcription factor 21).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 58 kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- KGFRENFESMYASVDTSVPSPPGPNCQLLGGDPFSPLLSNQYPVPSRFYPDLPGQPKDMISQPYWLGTPREHSYEAEFRAVSMKPTLLPSAPGPTVPYYRGQDVLAPGAGWPVAPQYPPKMSPAGWFRPMRTLPMDPGLGSSEEQGSSPSLWPEVTSLQPEPSDSGLGEGDTKRRRISPYPSSGDSSSPAGAPSPFDKETEGQFYNYFPN
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A28217