ABflo[R] 488 Rabbit anti-Mouse CD206/MMR monoclonal antibody
Produktgrößen
5 ug
£ POA
A28214-5UG
25 ug
£146,00
A28214-25UG
100 ug
£259,00
A28214-100UG
Über dieses Produkt
- SKU:
- A28214
- Zusätzliche Namen:
- CD206|MR
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Konjugat:
- ABflo® 488
- Weitere Details:
- Macrophage Mannose Receptor (MMR), also known as MR, is designated CD206, MRC1 (Mannose Receptor C-type 1), or CLEC13D (C-type Lectin Domain Family 13 Member D) due to its presence on cells beyond macrophages. CD206 is a 175 kDa endocytic receptor expressed on M2 selectively activated tissue macrophages, including tumor-associated macrophages (TAMs), inflammatory dendritic cells in specific lymphoid organs, and liver, spleen, lymphatic, and dermal microvascular endothelial cells.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 165 kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- LDARQFLIYNEDHKRCVDALSAISVQTATCNPEAESQKFRWVSDSQIMSVAFKLCLGVPSKTDWASVTLYACDSKSEYQKWECKNDTLFGIKGTELYFNYGNRQEKNIKLYKGSGLWSRWKVYGTTDDLCSRGYE
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A28214