PE Rabbit anti-Mouse IL-17F monoclonal antibody
Produktgrößen
2.5 ug
£ POA
A28170-2.5UG
25 ug
£152,00
A28170-25UG
100 ug
£336,00
A28170-100UG
Über dieses Produkt
- SKU:
- A28170
- Zusätzliche Namen:
- IL-17F
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Weitere Details:
- Enables cytokine receptor binding activity; protein heterodimerization activity; and protein homodimerization activity. Involved in defense response to bacterium and positive regulation of gene expression. Acts upstream of or within positive regulation of cytokine production involved in inflammatory response and positive regulation of transcription by RNA polymerase II. Located in extracellular space. Human ortholog(s) of this gene implicated in chronic mucocutaneous candidiasis. Orthologous to human IL17F (interleukin 17F).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 18 kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- MKCTRETAMVKSLLLLMLGLAILREVAARKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A28170