ABflo[R] 647 Rabbit anti-Mouse CD84 monoclonal antibody
Produktgrößen
5 ug
£ POA
A28104-5UG
25 ug
£146,00
A28104-25UG
100 ug
£306,00
A28104-100UG
Über dieses Produkt
- SKU:
- A28104
- Zusätzliche Namen:
- A130013D22Rik|CDw84|SLAMF5
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Konjugat:
- ABflo® 647
- Weitere Details:
- Predicted to enable identical protein binding activity. Involved in regulation of gene expression; regulation of macrophage activation; and regulation of signal transduction. Predicted to be located in plasma membrane. Predicted to be active in external side of plasma membrane. Is expressed in brain; embryo; and testis. Orthologous to human CD84 (CD84 molecule).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 37kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- KDADPMVMNGILGESVTFLLNIQEPKKIDNIAWTSQSSVAFIKPGVNKAEVTITQGTYKGRIEIIDQKYDLVIRDLRMEDAGTYKADINEENEETITKIYYLHIYRRLKTPKITQSLISSLNNTCNITLTCSVEKEEKDVTYSWSPFGEKSNVLQIVHSPMDQKLTYTCTAQNPVSNSSDSVTVQQPCTDTPSFHPRHAV
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A28104