RASGRP1 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A28098-20UL
100 ul
£336,00
A28098-100UL
500 ul
£1258,00
A28098-500UL
1000 ul
£2228,00
A28098-1000UL
Über dieses Produkt
- SKU:
- A28098
- Zusätzliche Namen:
- calDAG-GEFII|Rasgrp
- Anwendung:
- ELISA, Immunoprecipitation, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Predicted to enable several functions, including cation binding activity; diacylglycerol binding activity; and guanyl-nucleotide exchange factor activity. Involved in activation of GTPase activity; positive regulation of T cell differentiation in thymus; and positive regulation of natural killer cell differentiation. Acts upstream of or within several processes, including mast cell degranulation; regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction; and vesicle transport along microtubule. Predicted to be located in Golgi apparatus and cytosol. Predicted to be active in plasma membrane. Is expressed in several structures, including brain and olfactory epithelium. Used to study systemic lupus erythematosus. Human ortholog(s) of this gene implicated in immunodeficiency 64. Orthologous to human RASGRP1 (RAS guanyl releasing protein 1).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 90kDa/86kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse
- Sequenz:
- FPWVGGETTPGHFVLSSPRKSAQGALYVHSPASPCPSPALVRKRAFVKWENKESLIKPKPELHLRLRTYQELEQEINTLKADNDALKIQLKYAQKKIESLQLGKSNHVLAQMDHGDSA
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A28098