CLEC4E Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A28097-20UL
100 ul
£336,00
A28097-100UL
500 ul
£1258,00
A28097-500UL
1000 ul
£2228,00
A28097-1000UL
Über dieses Produkt
- SKU:
- A28097
- Zusätzliche Namen:
- Clecsf9|Mincle
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Enables glycolipid binding activity and pattern recognition receptor activity. Involved in antifungal innate immune response and positive regulation of cytokine production. Acts upstream of or within Fc-gamma receptor signaling pathway; T cell differentiation involved in immune response; and defense response to bacterium. Is active in phagocytic vesicle membrane and plasma membrane. Orthologous to human CLEC4E (C-type lectin domain family 4 member E).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 25kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Rat
- Sequenz:
- TQEEQEFLFRTKPKRKEFYIGLTDQVVEGQWQWVDDTPFTESLSFWDAGEPNNIVLVEDCATIRDSSNSRKNWNDIPCFYS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A28097