MYH6/A Alpha-MHC Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A28096-20UL
100 ul
£336,00
A28096-100UL
500 ul
£1258,00
A28096-500UL
1000 ul
£2228,00
A28096-1000UL
Über dieses Produkt
- SKU:
- A28096
- Zusätzliche Namen:
- A830009F23Rik|alpha-MHC|alphaMHC|Myhc-a|Myhca
- Anwendung:
- ELISA, IHC-Paraffin, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Enables microfilament motor activity. Involved in cardiac muscle contraction. Acts upstream of or within several processes, including adult heart development; regulation of heart contraction; and striated muscle cell development. Located in Z disc and stress fiber. Part of myosin complex. Is expressed in several structures, including brown fat; embryo mesenchyme; great vessel of heart; heart; and skeletal musculature. Used to study dilated cardiomyopathy; dilated cardiomyopathy 1EE; and hypertrophic cardiomyopathy 14. Human ortholog(s) of this gene implicated in atrial heart septal defect (multiple); heart conduction disease (multiple); and intrinsic cardiomyopathy (multiple). Orthologous to human MYH6 (myosin heavy chain 6).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 224kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse, Rat
- Sequenz:
- LFSTYASADTGDSGKGKGGKKKGSSFQTVSALHRENLNKLMTNLKTTHPHFVRCIIPNERKAPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDF
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A28096