PE Rabbit anti-Human CD134/OX40 monoclonal antibody
Produktgrößen
10 tests
£ POA
A28036-10TESTS
100 tests
£217,00
A28036-100TESTS
200 tests
£342,00
A28036-200TESTS
500 tests
£705,00
A28036-500TESTS
Über dieses Produkt
- SKU:
- A28036
- Zusätzliche Namen:
- ACT35|CD134|IMD16|OX40|TXGP1L
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Weitere Details:
- CD134, also known as OX40 and TNFRSF4, is a 50 kDa type I transmembrane glycoprotein. It is a member of the tumor necrosis factor receptor superfamily (TNFRSF). OX40 is expressed on activated T lymphocytes, including Th1, Th2, Th17, and Treg cell subsets. The interaction between OX40 and its ligand OX40L (TNFSF4) induces B cell proliferation and antibody secretion, and modulates primary T cell expansion and T cell survival. Furthermore, OX40 influences the size of the T cell memory pool and modulates CD4+ T cell tolerance.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 29kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human
- Sequenz:
- LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A28036