Chemerin Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A28009-20UL
100 ul
£336,00
A28009-100UL
500 ul
£1258,00
A28009-500UL
1000 ul
£2228,00
A28009-1000UL
Über dieses Produkt
- SKU:
- A28009
- Zusätzliche Namen:
- 0610007L05Rik
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Predicted to enable signaling receptor binding activity. Involved in several processes, including positive regulation of fat cell differentiation; regulation of insulin receptor signaling pathway; and regulation of primary metabolic process. Acts upstream of or within brown fat cell differentiation. Located in extracellular region. Is expressed in genitourinary system; jaw; and retina. Orthologous to human RARRES2 (retinoic acid receptor responder 2).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 18kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse, Rat
- Sequenz:
- EPELSETQRRSLQVALEEFHKHPPVQLAFQEIGVDRAEEVLFSAGTFVRLEFKLQQTNCPKKDWKKPECTIKPNGRRRKCLACIKMDPKGKILGRIVHCPILKQGPQDPQELQCIKIAQAGEDPHGYFLPGQFAFSRALRTK
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A28009