RNASE2 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A28007-20UL
100 ul
£336,00
A28007-100UL
500 ul
£1258,00
A28007-500UL
1000 ul
£2228,00
A28007-1000UL
Über dieses Produkt
- SKU:
- A28007
- Zusätzliche Namen:
- mR4|Rnase2|RNS2
- Anwendung:
- ELISA, IHC-Paraffin, Immunofluorescence, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Predicted to enable RNA nuclease activity and lipopolysaccharide binding activity. Predicted to be involved in chemotaxis; defense response to Gram-positive bacterium; and innate immune response in mucosa. Predicted to be located in lysosome. Predicted to be active in extracellular space. Orthologous to human RNASE2 (ribonuclease A family member 2) and RNASE3 (ribonuclease A family member 3).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 18kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- QAQILSQKFYTQHIYNSTYPRCDAVMRVVNRYRPRCKDINTFLHTSFADVVAVCGHPNITCNNLTRKNCHASSFQVFITFCNLTMPTRICTQCRYQTTGSVKYYRVACENRTPQDTPMYPVVPVHLDGTF
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A28007