CD133 Rabbit monoclonal antibody
Produktgrößen
5 ul
£ POA
A28001-5UL
20 ul
£164,00
A28001-20UL
100 ul
£342,00
A28001-100UL
500 ul
£1455,00
A28001-500UL
1000 ul
£2704,00
A28001-1000UL
Über dieses Produkt
- SKU:
- A28001
- Zusätzliche Namen:
- 4932416E19Rik|AC133|CD133|Prom|Prom-1|Proml1
- Anwendung:
- ELISA, IHC-Paraffin, Immunofluorescence, Immunoprecipitation, Western Blot
- Klonalität:
- Monoclonal
- Weitere Details:
- Predicted to enable actinin binding activity; cadherin binding activity; and cholesterol binding activity. Involved in camera-type eye photoreceptor cell differentiation and retina layer formation. Located in several cellular components, including brush border; photoreceptor outer segment; and prominosome. Is expressed in several structures, including brain; eye; genitourinary system; intestine; and neural ectoderm. Used to study retinitis pigmentosa 41. Human ortholog(s) of this gene implicated in cone-rod dystrophy 12; retinal macular dystrophy 2; and retinitis pigmentosa 41. Orthologous to human PROM1 (prominin 1).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 120 kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse, Rat
- Sequenz:
- EGQPAFHNTPGAMNYELPTTKYETQDTFNAGIVGPLYKMVHIFLNVVQPNDFPLDLIKKLIQNKNFDISVDSKEPEIIVLALKIALYE
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A28001