APC Rabbit anti-Mouse CD163 monoclonal antibody
Produktgrößen
2.5 ug
£ POA
A27963-2.5UG
25 ug
£164,00
A27963-25UG
100 ug
£324,00
A27963-100UG
Über dieses Produkt
- SKU:
- A27963
- Zusätzliche Namen:
- CD163v2|CD163v3|M130
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Konjugat:
- APC
- Weitere Details:
- CD163 is a member of the Group B scavenger receptor cysteine-rich (SRCR) superfamily. It is also known as GHI/61, M130, RM3/1, p155, the hemoglobin-haptoglobin complex receptor, or macrophage-associated antigen.It is a glycoprotein with an apparent molecular weight of 134 kDa under non-reducing conditions and 155 kDa under reducing conditions. CD163 is predominantly expressed on macrophages, Kupffer cells, monocytes, subsets of dendritic cells, and subsets of hematopoietic stem/progenitor cells.CD163 binds the haptoglobin-hemoglobin (Hp-Hb) complex and TNF-like weak inducer of apoptosis (TWEAK). It serves as the receptor for hemoglobin scavenging and modulates cytokine production by macrophages.Membrane-bound CD163 can be proteolytically cleaved by metalloproteinases (e.g., ADAM17, MMPs), releasing its soluble form (sCD163). Elevated serum levels of sCD163 have been strongly associated with numerous inflammatory diseases.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 121kDa/125kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- VTNAPGEMKKELRLAGGENNCSGRVELKIHDKWGTVCSNGWSMNEVSVVCQQLGCPTSIKALGWANSSAGSGYIWMDKVSCTGNESALWDCKHDGWGKHNCTHEKDAGVTCSDGSNLEMRLVNSAGHRCLGRVEIKFQGKWGTVCDDNFSKDHASVICKQLGCGSAISFSGSAKLGAGSGPIWLDDLACNGNESALWDCKHRGWGKHNCDHAEDVGVICLEG
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A27963