PE Rabbit anti-Mouse Podoplanin monoclonal antibody
Produktgrößen
2.5 ug
£ POA
A27940-2.5UG
50 ug
£152,00
A27940-50UG
100 ug
£229,00
A27940-100UG
200 ug
£360,00
A27940-200UG
500 ug
£753,00
A27940-500UG
Über dieses Produkt
- SKU:
- A27940
- Zusätzliche Namen:
- E11|Gp38|OTS-8|RANDAM-2|T1-alpha|T1a|T1alpha
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Weitere Details:
- Predicted to enable chaperone binding activity; chemokine binding activity; and signaling receptor binding activity. Involved in several processes, including lymph node development; lymphatic endothelial cell fate commitment; and positive regulation of platelet aggregation. Acts upstream of or within several processes, including lung alveolus development; lymphangiogenesis; and prostaglandin metabolic process. Located in several cellular components, including external side of plasma membrane; lamellipodium; and ruffle. Is expressed in several structures, including alimentary system; cardiovascular system; central nervous system; hemolymphoid system; and reproductive system. Orthologous to human PDPN (podoplanin).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 18kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- QGGTIGVNEDDIVTPGTGDGMVPPGIEDKITTTGATGGLNESTGKAPLVPTQRERGTKPPLEELSTSATSDHDHREHESTTTVKVVTSHSVDKKTSHPNRDNAGDETQTTDKK
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A27940