PE Rabbit anti-Mouse CD352/SLAMF6 monoclonal antibody
Produktgrößen
2.5 ug
£ POA
A27924-2.5UG
50 ug
£229,00
A27924-50UG
100 ug
£324,00
A27924-100UG
200 ug
£532,00
A27924-200UG
500 ug
£1133,00
A27924-500UG
Über dieses Produkt
- SKU:
- A27924
- Zusätzliche Namen:
- KAL1|KAL1b|Ly108|NTB-A|NTBA|SF2000
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Weitere Details:
- SLAMF6 (CD352/NTB-A) is a type I transmembrane glycoprotein belonging to the signaling lymphocyte activation molecule (SLAM) family of immunoregulatory receptors. Like other members of the SLAM receptor family, SLAMF6 possesses an extracellular region containing immunoglobulin (Ig)-like domains and an intracellular domain harboring conserved tyrosine-based signaling motifs. Upon phosphorylation, these motifs recruit the SAP (SLAM-associated protein) and EAT-2 adaptor signaling molecules. SLAMF6 is expressed on the surface of multiple immune cell lineages, including B cells, T cells, and natural killer (NK) cells. Its activation is triggered by homophilic interactions mediated through its extracellular domain. Functional studies demonstrate that SLAMF6 engagement in T cells promotes cellular activation and cytokine production. Similarly, ligand-induced homotypic binding of SLAMF6 in NK cells initiates signaling cascades that enhance proliferation, cytotoxic activity, and cytokine secretion.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 39kda
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- EVSQSSSDPQLMNGVLGESAVLPLKLPAGKIANIIIWNYEWEASQVTALVINLSNPESPQIMNTDVKKRLNITQSYSLQISNLTMADTGSYTAQITTKDSEVITFKYILRVFERLGNLETTNYTLLLENGTCQIHLACVLKNQSQTVSVEWQATGNISLGGPNVTIFWDPRNSGDQTYVCRAKNAVSNLSVSVSTQSLCKGVLTN
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A27924