HDAC6 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A27908-20UL
100 ul
£336,00
A27908-100UL
500 ul
£1258,00
A27908-500UL
1000 ul
£2228,00
A27908-1000UL
Über dieses Produkt
- SKU:
- A27908
- Zusätzliche Namen:
- Hd6|Hdac5|mHDA2|Sfc6
- Anwendung:
- ELISA, IHC-Paraffin, Immunocytochemistry, Immunofluorescence, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Enables several functions, including cytoskeletal protein binding activity; protein lysine deacetylase activity; and ubiquitin binding activity. Involved in several processes, including positive regulation of type 2 mitophagy; protein destabilization; and tubulin deacetylation. Acts upstream of or within several processes, including aggresome assembly; neuron projection morphogenesis; and protein modification process. Located in several cellular components, including dendrite; microtubule cytoskeleton; and perikaryon. Part of cytoplasmic ubiquitin ligase complex. Is expressed in several structures, including central nervous system; early embryo; gut gland; lung; and metanephros. Human ortholog(s) of this gene implicated in chondrodysplasia with platyspondyly, distinctive brachydactyly, hydrocephaly, and microphthalmia and polycystic liver disease 1. Orthologous to human HDAC6 (histone deacetylase 6).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 140kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- MKMEDKEECSSSRLVIKKLPPTASPVSAKEMTTPKGKVPEESVRKTIAALPGKESTLGQAKSKMAKAVLAQGQSSEQAAKGTTLDLATSKETVGGATTDLWASAAAPENFPNQTTSVEALGETEPTPPASHTNKQTTGASPLQGVTAQQSLQLGVLSTLELSREAEEAHDSEEGLLGEAAGGQDMNSLMLTQGFGDFNTQDV
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A27908