PE Rabbit anti-Mouse CD152/CTLA-4 monoclonal antibody
Produktgrößen
2.5 ug
£ POA
A27774-2.5UG
50 ug
£134,00
A27774-50UG
200 ug
£306,00
A27774-200UG
Über dieses Produkt
- SKU:
- A27774
- Zusätzliche Namen:
- Ctla4,Cd152,CTLA4
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Weitere Details:
- CD152, also known as CTLA-4 or Ly-56, is a 33 kDa member of the immunoglobulin superfamily. It is expressed on activated T and B lymphocytes. CD152 exhibits significant homology to CD28 in amino acid sequence, structural configuration, and genomic organization, with both receptors sharing ligands from the B7 family (B7-1 and B7-2). While CD28 delivers co-stimulatory signals during T cell activation, CTLA-4 functions as a critical negative regulator of cell-mediated immune responses. CD152 is implicated in the induction and maintenance of immune tolerance, the development of protective immunity, and the modulation of thymocyte homeostasis.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 24kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A27774