PE Rabbit anti-Mouse TNF-A Alpha monoclonal antibody
Produktgrößen
10 tests
£ POA
A27472-10TESTS
100 tests
£104,00
A27472-100TESTS
200 tests
£146,00
A27472-200TESTS
500 tests
£217,00
A27472-500TESTS
Über dieses Produkt
- SKU:
- A27472
- Zusätzliche Namen:
- DIF|TNF-a|TNF-alpha|Tnfa|TNFalpha|Tnfsf1a|TNFSF2|Tnlg1f
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Weitere Details:
- This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. Members of this family are classified based on primary sequence, function, and structure. This protein is synthesized as a type-II transmembrane protein and is reported to be cleaved into products that exert distinct biological functions. It plays an important role in the innate immune response as well as regulating homeostasis but is also implicated in diseases of chronic inflammation. In mouse deficiency of this gene is associated with defects in response to bacterial infection, with defects in forming organized follicular dendritic cell networks and germinal centers, and with a lack of primary B cell follicles. Alternative splicing results in multiple transcript variants.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 26kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A27472