Biotin Rabbit anti-Mouse CD5 monoclonal antibody
Produktgrößen
10 tests
£ POA
A27413-10TESTS
200 tests
£98,00
A27413-200TESTS
500 tests
£122,00
A27413-500TESTS
Über dieses Produkt
- SKU:
- A27413
- Zusätzliche Namen:
- Ly-1|Ly-12|Ly-A|Lyt-1
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Konjugat:
- Biotin
- Weitere Details:
- CD5 is a type I transmembrane protein belonging to the scavenger receptor cysteine-enriched (SRCR) family, characterized by the presence of at least one SRCR domain containing 90-110 amino acids. CD5 is expressed in all mature T cells, B-1A subsets of mature B cells, and certain leukemia B cells. It is elevated in regulatory T and B cells (Tregs/Bregs). CD5 expression was also elevated in incompetent T and B cells. Elevated levels of CD5 have also been found in many autoimmune diseases. CD5 binds to T cell receptors (TCR) and negatively regulates T cell activation and differentiation. The expression of CD5 in tumor-infiltrating T lymphocytes was negatively correlated with their antitumor activity. Recently, it has been reported that CD5 binds directly to IL6 and mediates downstream signal transduction. CD5+ B cells promote tumor growth in animal models. Agents targeting CD5 are being actively explored as therapeutic interventions for cancer and other conditions.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 54kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- SGRGGLDIQVMLSGSNSKCQGQVEIQMENKWKTVCSSSWRLSQDHSKNAQQASAVCKQLRCGDPLALGPFPSLNRPQNQVFCQGSPWSISNCNNTSSQDQCLPLSLICLEPQRTTPPPTTTPPTTVPEPTAPPRLQLVPGHEGLRCTGVVEFYNGSWGGTILYKAKDRPLGLGNLICKSLQCGSFLTHLSGTEAAGTPAPAELRDPRPLPIRWEAPNGSCVSLQQCFQKTTAQEGGQALTVICSDFQPKVQSRLVGGSSVCEGIAEVRQRSQWEALCDSSAARGRGRWEELCREQQCGDLISFHTVDADKTSPGFLCAQEKLSQCYHLQKKKHCNKRVFVTCQDPNP
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A27413