Biotin Rabbit anti-Mouse NK1.1/CD161c monoclonal antibody
Produktgrößen
10 tests
£ POA
A27412-10TESTS
200 tests
£86,00
A27412-200TESTS
500 tests
£116,00
A27412-500TESTS
Über dieses Produkt
- SKU:
- A27412
- Zusätzliche Namen:
- CD161|Klrb1b|ly-55c|Ly-59|Ly55c|Ly59|Nk-1|Nk-1.2|NK-RP1|Nk1|NK1.1|Nk1.2|NKR-P1.9|NKRP1|NKRP140|Nkrp1b|Nkrp1c
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Konjugat:
- Biotin
- Weitere Details:
- Enables identical protein binding activity and signaling receptor activity. Acts upstream of or within natural killer cell activation and positive regulation of natural killer cell mediated cytotoxicity. Located in external side of plasma membrane. Is integral component of plasma membrane. Is expressed in thymus primordium. Orthologous to human KLRB1 (killer cell lectin like receptor B1).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 25kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- QKPSREKCCVFIQENLNKTTDCSVNLECPQDWLLHRDKCFHVSQVSNTWEEGQADCGRKGATLLLIQDQEELRFLLDSIKEKYNSFWIGLRFTLPDMNWKWINGTTFNSDVLKITGVTENGSCASILGDKVTPESCASDNRWICQKELNHETPSNDS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A27412