PE/Cyanine5 Rabbit anti-Mouse CD11b monoclonal antibody
Produktgrößen
10 tests
£ POA
A27344-10TESTS
100 tests
£116,00
A27344-100TESTS
200 tests
£152,00
A27344-200TESTS
500 tests
£241,00
A27344-500TESTS
Über dieses Produkt
- SKU:
- A27344
- Zusätzliche Namen:
- Cd11b|CD11b/CD18|CR3|CR3A|F730045J24Rik|Ly-40|Mac-1|Mac-1a|MAC1
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Konjugat:
- R-PE-Cyanine 5
- Weitere Details:
- Enables complement component C3b binding activity; heparan sulfate proteoglycan binding activity; and heparin binding activity. Contributes to cargo receptor activity. Involved in several processes, including central nervous system development; endocytosis; and positive regulation of neuron death. Acts upstream of or within several processes, including activated T cell proliferation; leukocyte migration; and microglia development. Located in external side of plasma membrane and nucleus. Is integral component of membrane. Part of integrin alphaM-beta2 complex. Is expressed in several structures, including central nervous system; heart; lymphatic vessel; thymus; and yolk sac. Human ortholog(s) of this gene implicated in lupus nephritis. Orthologous to human ITGAM (integrin subunit alpha M).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 127kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- ECPQQESDIVFLIDGSGSINNIDFQKMKEFVSTVMEQFKKSKTLFSLMQYSDEFRIHFTFNDFKRNPSPRSHVSPIKQLNGRTKTASGIRKVVRELFHKTNGARENAAKILVVITDGEKFGDPLDYKDVIPEADRAGVIRYVIGVGNAFNKPQSRRELDTIASKPAGEHVFQVDNFEALNTIQNQLQEKIFAIEG
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A27344