PE Rabbit anti-Mouse CD11a monoclonal antibody
Produktgrößen
10 tests
£ POA
A27336-10TESTS
100 tests
£104,00
A27336-100TESTS
200 tests
£134,00
A27336-200TESTS
500 tests
£199,00
A27336-500TESTS
Über dieses Produkt
- SKU:
- A27336
- Zusätzliche Namen:
- (p180)|Cd11a|LFA-1|LFA-1A|Ly-15|Ly-21
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Weitere Details:
- Predicted to enable ICAM-3 receptor activity and cell adhesion molecule binding activity. Involved in cell-cell adhesion. Acts upstream of or within several processes, including activated T cell proliferation; positive regulation of T cell proliferation; and positive regulation of calcium-mediated signaling. Located in cell-cell junction; external side of plasma membrane; and immunological synapse. Is expressed in heart; hemolymphoid system; and vault of skull. Orthologous to human ITGAL (integrin subunit alpha L).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 128kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- KGKVDLVFLFDGSQSLDRKDFEKILEFMKDVMRKLSNTSYQFAAVQFSTDCRTEFTFLDYVKQNKNPDVLLGSVQPMFLLTNTFRAINYVVAHVFKEESGARPDATKVLVIITDGEASDKGNISAAHDITRYIIGIGKHFVSVQKQKTLHIFASEPVEEFVKILDTFEKLKDLFTDLQRRIYAIEGTNRQDL
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A27336