ABflo[R] 647 Rabbit anti-Mouse CD204 monoclonal antibody
Produktgrößen
10 tests
£ POA
A27279-10TESTS
100 tests
£181,00
A27279-100TESTS
200 tests
£277,00
A27279-200TESTS
500 tests
£467,00
A27279-500TESTS
Über dieses Produkt
- SKU:
- A27279
- Zusätzliche Namen:
- MRS-A|MSR|MSR-A|Scara1|Scvr|SR-A|SR-AI|SR-AII
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Konjugat:
- ABflo® 647
- Weitere Details:
- Enables amyloid-beta binding activity; cargo receptor activity; and low-density lipoprotein particle binding activity. Involved in several processes, including endocytosis; positive regulation of cholesterol storage; and positive regulation of macrophage derived foam cell differentiation. Acts upstream of or within establishment of localization in cell and lipoprotein transport. Located in plasma membrane. Is expressed in several structures, including alimentary system; early conceptus; limb; neural tube; and reproductive system. Human ortholog(s) of this gene implicated in Barrett's esophagus; arteriosclerosis; and prostate cancer. Orthologous to human MSR1 (macrophage scavenger receptor 1).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 50kda
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- GSTPLKTVRLVGGSGAHEGRVEIFHQGQWGTICDDRWDIRAGQVVCRSLGYQEVLAVHKRAHFGQGTGPIWLNEVMCFGRESSIENCKINQWGVLSCSHSEDAGVTCTS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A27279