ABflo[R] 488 Rabbit anti-Mouse IL-22 monoclonal antibody
Produktgrößen
10 tests
£ POA
A27210-10TESTS
100 tests
£199,00
A27210-100TESTS
200 tests
£294,00
A27210-200TESTS
500 tests
£503,00
A27210-500TESTS
Über dieses Produkt
- SKU:
- A27210
- Zusätzliche Namen:
- If2b1|IL-22|IL-22a|Iltif|ILTIFa
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Konjugat:
- ABflo® 488
- Weitere Details:
- Enables cytokine activity. Involved in negative regulation of inflammatory response. Acts upstream of or within positive regulation of transcription by RNA polymerase II; reactive oxygen species metabolic process; and regulation of tyrosine phosphorylation of STAT protein. Is active in extracellular space. Is expressed in ileum; retina; and skin. Used to study liposarcoma. Human ortholog(s) of this gene implicated in asthma. Orthologous to human IL22 (interleukin 22).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 20kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A27210