ABflo[R] 488 Rabbit anti-Mouse I-A monoclonal antibody
Produktgrößen
10 tests
£ POA
A27182-10TESTS
100 tests
£503,00
A27182-100TESTS
200 tests
£824,00
A27182-200TESTS
500 tests
£1478,00
A27182-500TESTS
Über dieses Produkt
- SKU:
- A27182
- Zusätzliche Namen:
- H-2I|I-Ad, -Ed|I-Eb and I-Ek MHC class II alloantigens|Ia Ag|MHC II
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Konjugat:
- ABflo® 488
- Weitere Details:
- Enables several functions, including peptide antigen binding activity; protein antigen binding activity; and toxic substance binding activity. Involved in several processes, including B cell affinity maturation; cellular response to interferon-gamma; and positive regulation of T-helper 1 type immune response. Acts upstream of or within antigen processing and presentation of exogenous peptide antigen via MHC class II and immune response. Located in Golgi apparatus; endosome; and external side of plasma membrane. Is integral component of membrane. Part of MHC class II protein complex. Is expressed in lung; metanephros; and thymus primordium. Orthologous to human HLA-DQB2 (major histocompatibility complex, class II, DQ beta 2).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 30kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- SERHFVFQFKGECYFTNGTQRIRSVDRYIYNREEYLRFDSDVGEYRAVTELGRPDAEYYNKQYLEQTRAELDTVCRHNYEGVETHTSLRRLEQPNVVISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLISNGDWTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWRAQSE
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A27182