ABflo[R] 647 Rabbit anti-Mouse CD265/RANK monoclonal antibody
Produktgrößen
10 tests
£ POA
A27179-10TESTS
100 tests
£277,00
A27179-100TESTS
200 tests
£437,00
A27179-200TESTS
500 tests
£764,00
A27179-500TESTS
Über dieses Produkt
- SKU:
- A27179
- Zusätzliche Namen:
- Ly109|mRANK|ODFR|OFE|Rank|TRANCE-R
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Konjugat:
- ABflo® 647
- Weitere Details:
- Enables tumor necrosis factor-activated receptor activity. Involved in several processes, including circadian temperature homeostasis; positive regulation of fever generation by positive regulation of prostaglandin secretion; and tumor necrosis factor-mediated signaling pathway. Acts upstream of or within several processes, including hematopoietic or lymphoid organ development; mammary gland alveolus development; and positive regulation of bone resorption. Located in cell surface. Is expressed in bladder and lymphatic system. Human ortholog(s) of this gene implicated in Paget's disease of bone; autosomal recessive osteopetrosis 7; bone development disease; familial expansile osteolysis; and osteoporosis. Orthologous to human TNFRSF11A (TNF receptor superfamily member 11a).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 67kda
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- VTPPCTQERHYEHLGRCCSRCEPGKYLSSKCTPTSDSVCLPCGPDEYLDTWNEEDKCLLHKVCDAGKALVAVDPGNHTAPRRCACTAGYHWNSDCECCRRNTECAPGFGAQHPLQLNKDTVCTPCLLGFFSDVFSSTDKCKPWTNCTLLGKLEAHQGTTESDVVCSSSMTLRRPPKEAQAYLP
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A27179