ABflo[R] 488 Rabbit anti-Mouse CD270/HVEM monoclonal antibody
Produktgrößen
10 tests
£ POA
A27135-10TESTS
100 tests
£152,00
A27135-100TESTS
200 tests
£229,00
A27135-200TESTS
500 tests
£384,00
A27135-500TESTS
Über dieses Produkt
- SKU:
- A27135
- Zusätzliche Namen:
- Atar|HveA|Hvem|Tnfrs14|TR2
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Konjugat:
- ABflo® 488
- Weitere Details:
- Predicted to enable cytokine binding activity and ubiquitin protein ligase binding activity. Acts upstream of or within several processes, including defense response to bacterium; negative regulation of alpha-beta T cell proliferation; and positive regulation of macromolecule metabolic process. Located in external side of plasma membrane. Is expressed in liver lobe. Orthologous to human TNFRSF14 (TNF receptor superfamily member 14).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 30kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- QPSCRQEEFLVGDECCPMCNPGYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQV
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A27135