ABflo[R] 700 Rabbit anti-Human CD185/CXCR5 monoclonal antibody
Produktgrößen
10 tests
£ POA
A26891-10TESTS
100 tests
£336,00
A26891-100TESTS
200 tests
£526,00
A26891-200TESTS
500 tests
£931,00
A26891-500TESTS
Über dieses Produkt
- SKU:
- A26891
- Zusätzliche Namen:
- BLR1|CD185|MDR15
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Konjugat:
- ABflo® 700
- Weitere Details:
- This gene encodes a multi-pass membrane protein that belongs to the CXC chemokine receptor family. It is expressed in mature B-cells and Burkitt's lymphoma. This cytokine receptor binds to B-lymphocyte chemoattractant (BLC), and is involved in B-cell migration into B-cell follicles of spleen and Peyer patches. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 42kda
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human
- Sequenz:
- MNYPLTLEMDLENLEDLFWELDRLDNYNDTSLVENHLCPATEGPLMA
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A26891