ABflo[R] 647 Rabbit anti-Mouse CD200/OX-2 monoclonal antibody
Produktgrößen
10 tests
£ POA
A26860-10TESTS
100 tests
£134,00
A26860-100TESTS
200 tests
£199,00
A26860-200TESTS
500 tests
£324,00
A26860-500TESTS
Über dieses Produkt
- SKU:
- A26860
- Zusätzliche Namen:
- Mox2|OX2
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Konjugat:
- ABflo® 647
- Weitere Details:
- Predicted to enable protein binding activity involved in heterotypic cell-cell adhesion. Involved in negative regulation of cell population proliferation; negative regulation of macrophage activation; and negative regulation of neuroinflammatory response. Located in cell surface. Is expressed in several structures, including anterior naris; aorta; bone; nervous system; and retina. Used to study autoimmune disease. Orthologous to human CD200 (CD200 molecule).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 31kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- QVEVVTQDERKALHTTASLRCSLKTSQEPLIVTWQKKKAVSPENMVTYSKTHGVVIQPAYKDRINVTELGLWNSSITFWNTTLEDEGCYMCLFNTFGSQKVSGTACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGTGIENSTESHFHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSLDKG
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A26860