PE Rabbit anti-Human IgA1 monoclonal antibody
Produktgrößen
10 tests
£ POA
A26802-10TESTS
100 tests
£324,00
A26802-100TESTS
200 tests
£509,00
A26802-200TESTS
500 tests
£782,00
A26802-500TESTS
Über dieses Produkt
- SKU:
- A26802
- Zusätzliche Namen:
- IgA1
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Weitere Details:
- Ig alpha is the major immunoglobulin class in body secretions. It may serve both to defend against local infection and to prevent access of foreign antigens to the general immunologic system. In normal adult serum, the approximate percentage composition of IgA with respect to is subclasses is IgA1:90% and IgA2:10%. In secretory IgA, the subclass proportions may approach 50:50. The clinical significance of the subclasses has yet to be determined.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 38kDa/42KDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human
- Sequenz:
- VPCPVPSTPPTPSPSTPPTPSPSCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAEPWNHGKTFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLADWQMPPPYVVLDLPQETLEE
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Secondary Antibodies
- Datenblatt des Herstellers:A26802