ABflo[R] 488 Rabbit anti-Mouse CD182/CXCR2 monoclonal antibody
Produktgrößen
10 tests
£ POA
A26757-10TESTS
100 tests
£247,00
A26757-100TESTS
200 tests
£384,00
A26757-200TESTS
500 tests
£657,00
A26757-500TESTS
Über dieses Produkt
- SKU:
- A26757
- Zusätzliche Namen:
- CD128|CDw128|Cmkar2|Gpcr16|IL-8rb|IL-8Rh|IL8RA|Il8rb|mIL-8RH
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Konjugat:
- ABflo® 488
- Weitere Details:
- Enables chemokine receptor activity. Acts upstream of or within negative regulation of apoptotic process. Predicted to be located in several cellular components, including cell surface; mast cell granule; and mitotic spindle. Predicted to be active in external side of plasma membrane. Is expressed in several structures, including alimentary system; central nervous system; embryo mesenchyme; epithelium; and heart. Human ortholog(s) of this gene implicated in IgA glomerulonephritis; acute pyelonephritis; end stage renal disease; and urinary bladder cancer. Orthologous to human CXCR2 (C-X-C motif chemokine receptor 2).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 40kda
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- MGEFKVDKFNIEDFFSGDLDIFNYSSGMPSILPDAVPCHSENLE
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A26757