ABflo[R] 647 Rabbit anti-Mouse CD62L/L-Selectin monoclonal antibody
Produktgrößen
10 tests
£ POA
A26716-10TESTS
100 tests
£104,00
A26716-100TESTS
200 tests
£134,00
A26716-200TESTS
500 tests
£211,00
A26716-500TESTS
Über dieses Produkt
- SKU:
- A26716
- Zusätzliche Namen:
- CD62L|L-selectin|LAM-1|LECAM-1|LECAM1|Lnhr|Ly-22|Ly-m22|Lyam-1|Lyam1
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Konjugat:
- ABflo® 647
- Weitere Details:
- Enables cell adhesion molecule binding activity. Acts upstream of or within response to ATP. Located in external side of plasma membrane. Is expressed in brain; brainstem; submandibular gland epithelium; and testis. Used to study type 1 diabetes mellitus. Human ortholog(s) of this gene implicated in Crohn's disease; IgA glomerulonephritis; and ulcerative colitis. Orthologous to human SELL (selectin L).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 42kda
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- WTYHYSEKPMNWENARKFCKQNYTDLVAIQNKREIEYLENTLPKSPYYYWIGIRKIGKMWTWVGTNKTLTKEAENWGAGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPGSCNGRGECVETINNHTCICDAGYYGPQCQYVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQETNRSFSKIKEGDYN
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A26716