ABflo[R] 488 Rabbit anti-Mouse CD88/C5aR monoclonal antibody
Produktgrößen
10 tests
£ POA
A26710-10TESTS
100 tests
£259,00
A26710-100TESTS
200 tests
£402,00
A26710-200TESTS
500 tests
£693,00
A26710-500TESTS
Über dieses Produkt
- SKU:
- A26710
- Zusätzliche Namen:
- C5aR|C5r1|Cd88|D7Msu1
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Konjugat:
- ABflo® 488
- Weitere Details:
- Enables complement component C5a receptor activity. Involved in several processes, including astrocyte activation; positive regulation of vascular endothelial growth factor production; and regulation of granulocyte chemotaxis. Acts upstream of or within defense response to Gram-positive bacterium; neutrophil chemotaxis; and response to peptidoglycan. Predicted to be located in several cellular components, including apical part of cell; basolateral plasma membrane; and cell surface. Predicted to be active in plasma membrane. Is expressed in several structures, including brain; liver; neural ectoderm; and sensory organ. Orthologous to several human genes including OPRPN (opiorphin prepropeptide).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 39kda
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- MDPIDNSSFEINYDHYGTMDPNIPADGIHLPKRQPGD
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A26710