ABflo[R] 488 Rabbit anti-Mouse CD87 monoclonal antibody
Produktgrößen
10 tests
£ POA
A26600-10TESTS
100 tests
£503,00
A26600-100TESTS
200 tests
£824,00
A26600-200TESTS
500 tests
£1478,00
A26600-500TESTS
Über dieses Produkt
- SKU:
- A26600
- Zusätzliche Namen:
- Cd87|u-PAR|uPAR
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Konjugat:
- ABflo® 488
- Weitere Details:
- Predicted to enable enzyme binding activity; protein domain specific binding activity; and signaling receptor binding activity. Predicted to be involved in several processes, including negative regulation of apoptotic signaling pathway; positive regulation of epidermal growth factor receptor signaling pathway; and positive regulation of release of cytochrome c from mitochondria. Is integral component of plasma membrane. Is expressed in several structures, including decidua; early conceptus; and spleen. Human ortholog(s) of this gene implicated in rheumatoid arthritis. Orthologous to human PLAUR (plasminogen activator, urokinase receptor).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 24kDa/35kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- LQCMQCESNQSCLVEECALGQDLCRTTVLREWQDDRELEVVTRGCAHSEKTNRTMSYRMGSMIISLTETVCATNLCNRPRPGARGRAFPQGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSLKDEDYTRGCGSLPGCPGTAGFHSNQTFHFLKCCNYTHCNGGPVLDLQSFPPNGFQCYSCEGNNTLGCSSEEASLINCRGPMNQCLVATGLDVLGNRSYTVRGCATASWCQGSHVADSFPTHLNVSVSCCHGSGCNSPT
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A26600