PE Rabbit anti-Mouse PD-L2/CD273/B7-DC monoclonal antibody
Produktgrößen
10 tests
£ POA
A26554-10TESTS
100 tests
£259,00
A26554-100TESTS
200 tests
£402,00
A26554-200TESTS
500 tests
£693,00
A26554-500TESTS
Über dieses Produkt
- SKU:
- A26554
- Zusätzliche Namen:
- B7-DC|Btdc|F730015O22Rik|PD-L2
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Weitere Details:
- Acts upstream of or within negative regulation of T cell proliferation and positive regulation of T cell proliferation. Predicted to be located in plasma membrane. Predicted to be integral component of membrane. Predicted to be active in external side of plasma membrane. Is expressed in several structures, including alimentary system epithelium; forebrain; nose; retina; and skin. Orthologous to human PDCD1LG2 (programmed cell death 1 ligand 2).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 28kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- LFTVTAPKEVYTVDVGSSVSLECDFDRRECTELEGIRASLQKVENDTSLQSERATLLEEQLPLGKALFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASY
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A26554