ABflo[R] 647 Rabbit anti-Mouse IL-9 monoclonal antibody
Produktgrößen
10 tests
£ POA
A26285-10TESTS
100 tests
£199,00
A26285-100TESTS
200 tests
£294,00
A26285-200TESTS
500 tests
£503,00
A26285-500TESTS
Über dieses Produkt
- SKU:
- A26285
- Zusätzliche Namen:
- Il-9|P40
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Konjugat:
- ABflo® 647
- Weitere Details:
- Enables cytokine activity. Involved in positive regulation of interleukin-5 production. Acts upstream of or within several processes, including B cell activation; regulation of cellular protein metabolic process; and regulation of receptor signaling pathway via JAK-STAT. Located in extracellular space. Is expressed in gut; liver; thymus; and thymus primordium. Human ortholog(s) of this gene implicated in asthma and respiratory syncytial virus infectious disease. Orthologous to human IL9 (interleukin 9).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- Refer to figures
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- QRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCN
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A26285