ABflo[R] 647 Conjugated AIF1/IBA1 Rabbit monoclonal antibody
Produktgrößen
5 ul
£ POA
A26033-5UL
20 ul
£211,00
A26033-20UL
100 ug
£479,00
A26033-100UG
500 ul
£1865,00
A26033-500UL
1000 ul
£3323,00
A26033-1000UL
Über dieses Produkt
- SKU:
- A26033
- Zusätzliche Namen:
- AIF-1|D17H6S50E|G1|Iba1
- Anwendung:
- Immunofluorescence, Western Blot
- Klonalität:
- Monoclonal
- Konjugat:
- ABflo® 647
- Weitere Details:
- Enables actin filament binding activity and calcium ion binding activity. Involved in several processes, including Rac protein signal transduction; actin filament organization; and ruffle assembly. Acts upstream of or within actin filament bundle assembly. Located in several cellular components, including actin filament; phagocytic cup; and ruffle membrane. Is expressed in adrenal cortex; central nervous system; embryo mesenchyme; and retina. Human ortholog(s) of this gene implicated in type 1 diabetes mellitus. Orthologous to human AIF1 (allograft inflammatory factor 1).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 17kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- MSQSRDLQGGKAFGLLKAQQEERLEGINKQFLDDPKYSNDEDLPSKLEAFKVKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKRLIREVSSGSEET
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A26033