ABflo[R] 488 Rabbit anti-Mouse VISTA PolymAb[R]
Produktgrößen
100 tests
£306,00
A25973PM-100TESTS
200 tests
£485,00
A25973PM-200TESTS
500 tests
£860,00
A25973PM-500TESTS
Über dieses Produkt
- SKU:
- A25973PM
- Zusätzliche Namen:
- 4632428N05Rik|Dies1|PD-1H|VISTA
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Konjugat:
- ABflo® 488
- Weitere Details:
- Predicted to enable endopeptidase activator activity; enzyme binding activity; and identical protein binding activity. Acts upstream of or within several processes, including negative regulation of CD4-positive, alpha-beta T cell proliferation; negative regulation of T cell cytokine production; and positive regulation of BMP signaling pathway. Located in external side of plasma membrane. Is expressed in several structures, including heart; immune system; lung; male reproductive gland or organ; and small intestine lamina propria. Orthologous to human VSIR (V-set immunoregulatory receptor).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 34kda
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- FKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAA
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A25973PM