Fibronectin Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A25907-20UL
100 ug
£336,00
A25907-100UG
500 ul
£1258,00
A25907-500UL
1000 ul
£2228,00
A25907-1000UL
Über dieses Produkt
- SKU:
- A25907
- Zusätzliche Namen:
- E330027I09|Fn|Fn-1
- Anwendung:
- ELISA, Immunocytochemistry, Immunofluorescence, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Enables peptidase activator activity. Acts upstream of or within several processes, including calcium-independent cell-matrix adhesion; cell-substrate junction assembly; and positive regulation of axon extension. Located in apical plasma membrane and basement membrane. Is expressed in several structures, including alimentary system; cardiovascular system; egg cylinder; embryo mesenchyme; and genitourinary system. Human ortholog(s) of this gene implicated in calcium oxalate nephrolithiasis; membranoproliferative glomerulonephritis; and spondylometaphyseal dysplasia corner fracture type. Orthologous to human FN1 (fibronectin 1).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 272 kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- ALSQTTISWTPFQESSEYIISCQPVGTDEEPLQFQVPGTSTSATLTGLTRGVTYNIIVEALQNQRRHKVREEVVTVGNAVSEGLNQPTDDSCFDPYTVSHYAIGEEWERLSDAGFKLTCQCLGFGSGHFRCDSSKWCHDNGVNYKIGEKWDRQGENGQRMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGAAEPSPDGTTGHTYNQYTQRYNQRTNTNVNCPIECFMPLDVQADRDDSRE
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A25907