PE Rabbit anti-Mouse CD121a/IL1R1 monoclonal antibody
Produktgrößen
10 tests
£ POA
A25858-10TESTS
100 tests
£265,00
A25858-100TESTS
200 tests
£407,00
A25858-200TESTS
500 tests
£622,00
A25858-500TESTS
Über dieses Produkt
- SKU:
- A25858
- Zusätzliche Namen:
- CD121a|CD121b|IL-1R-1|IL-1R-alpha|IL-1R1|IL-1RT-1|IL-1RT1|IL-iR|Il1r-1
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Weitere Details:
- Enables interleukin-1 binding activity; interleukin-1 receptor activity; and protease binding activity. Involved in interleukin-1-mediated signaling pathway. Acts upstream of or within several processes, including cytokine-mediated signaling pathway; positive regulation of interleukin-1-mediated signaling pathway; and positive regulation of neutrophil extravasation. Located in external side of plasma membrane. Is expressed in brain; dorsal aorta; liver; reproductive system; and spleen. Used to study type 1 diabetes mellitus. Human ortholog(s) of this gene implicated in systemic scleroderma and type 1 diabetes mellitus. Orthologous to human IL1R1 (interleukin 1 receptor type 1).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 67kda
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- LEIDVCTEYPNQIVLFLSVNEIDIRKCPLTPNKMHGDTIIWYKNDSKTPISADRDSRIHQQNEHLWFVPAKVEDSGYYYCIVRNSTYCLKTKVTVTVLENDPGLCYSTQATFPQRLHIAGDGSLVCPYVSYFKDENNELPEVQWYKNCKPLLLDNVSFFGVKDKLLVRNVAEEHRGDYICRMSYTFRGKQYPVTRVIQFITIDENKRDRPVILSPRNETIEADPGSMIQLICNVTGQFSDLVYWKWNGSEIEWNDPFLAEDYQFVEHPSTKRKYTLITTLNISEVKSQFYRYPFICVVKNTNIFESAHVQLIYPVPDFK
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A25858