CCR7 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A25849-20UL
100 ug
£336,00
A25849-100UG
500 ul
£1258,00
A25849-500UL
1000 ul
£2228,00
A25849-1000UL
Über dieses Produkt
- SKU:
- A25849
- Zusätzliche Namen:
- CC-CKR-7|CCR-7|CD197|Cdw197|Cmkbr7|EBI1|Ebi1h
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Enables C-C chemokine receptor activity. Involved in several processes, including positive regulation of immune response; positive regulation of leukocyte chemotaxis; and regulation of cytokine production. Acts upstream of or within chemotaxis; homeostasis of number of cells; and immune response. Located in external side of plasma membrane. Is expressed in several structures, including alimentary system; central nervous system; immune system; reproductive system; and white fat. Used to study Sjogren's syndrome. Orthologous to human CCR7 (C-C motif chemokine receptor 7).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 43-50kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Rat
- Sequenz:
- SLVSAQVEALITIQVAQMVFGFLVPMLAMSFCYLIIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYNGVVLAQTVANFNITNSSCETSKQLNIAYDV
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A25849